T1094 Domain 4 Parse 1 Confidence: 0.00

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
33153CompleteStructure predictioncaspT109449623 Jul 2020-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
32176410.00comparative modeling430-4966723 Jul 2020
                  .  440    .  450    .  460    .  470    .  480    .  490    . 
   sequence: TNNKLRGLHPSYLGRLGLTSTSAGDPGASGSLTPFLELPENSYMHFTEEPEINLNIDDISIDEVIES
 deepconcnf: -------------EEEEEEE---------EEEE----------EEE-----EEEEE----HHHHH--
    psipred: ------------EEEEEE-----------EEE-HHHH------EEE-----EEEEE----HHHHH--
    spider3: -------------EEEEEE-------------------------EE------EEEEHHEEHHHE---
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington