SSGCID - NieuA.20425.a Cytochrome P460 domain-containing protein Domain 1 Parse 1 Confidence: 0.62

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
33237CompleteStructure prediction ssgcidSSGCID - NieuA.20425.a Cy...17424 Jul 2020-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
32263110.62comparative modeling1-17417424 Jul 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    
   sequence: MKSSFGLSALVGLTLSLHAYAGGNPEFVKFPEKYEQIFTHYDTANRANQTQLAKFYANEIAAESYKKGEEAAPGSIVIMEIYAPKKDAEGKIQSGEDGLFVIDKLAAIAVMEKRNDWGSAFKADDRSGNWGFALYDPEGKAKDNDLTCAQCHNPLQKQDNLFSFQKLVDYVKAH
 deepconcnf: --HHHHHHHHHHHHHHH----------------HHHH-EEEEE--------EEEEEE-HHHHHHHH---------EEEEEEEE--------EEE-----EEE--EEEEEEEEEE---------------EEEEEE-------------------------EEE-----------
    psipred: --HHHHHHHHHHHHHHH----------------HHH--EEEEEEEE----EEEEEEE-HHHHHHHHH--------EEEEEEEE---------------------EEEEEEEEEE----------------EEEEE-------------HHH---HH----EEE---HH------
    spider3: ----HHHHHHHHHHHHHHH--------------HHH--EEEEEEEE----EEEEEEE-HHHHHHHH---------EEEEEEEEEEE-----E-------EE----EEEEEEEE----------------EEEEEE-----E-------HHHHHHHH----EEE--HHHH-----
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington