SSGCID - MygeA.20032.a 50S ribosomal protein L33 1 MG_325 Domain 1 Parse 1 Confidence: 0.69

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
3004CompleteStructure predictionssgcidSSGCID - MygeA.20032.a 50...5317 Apr 2019-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
3289110.69comparative modeling1-535322 Apr 2019
             1   .   10    .   20    .   30    .   40    .   50   
   sequence: MAVKRSTRLGCNECSEINYLTFKNVKKNPEKLALNKFCSRCRKVVLHKEVKRK
 deepconcnf: ------EEEE-------EEE----------HHHHHH-----------------
    psipred: -----EEEEE--------------------EEEEEE----------EEEEE--
    spider3: ----EEEEEE------EEEEEE---------EEEEEE------EEEEEEEE--
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington