2022-06-25_00000109_1_11 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
347296 | Error | Structure prediction | cameo | 2022-06-25_00000109_1_11 | 73 | 25 Jun 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
342868 | 1 | 1 | n/a | TrRefineRosetta | 1-73 | 73 | 25 Jun 2022 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: PLGSVSEACPVCEKTVQNPCVLETGYVACYPCAISYLVNNEGHCPVTNKKLLGCTYNKHTNKWEVVTGIRKLI
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington