2022-07-02_00000191_1_19 Domain 1 Parse 2 Confidence: 0.26
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 355921 | Complete | Structure prediction | RoseTTAFold | 2022-07-02_00000191_1_19 | 1187 | 2 Jul 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 361453 | 1 | 2 | 0.26 | ab initio | 1-65 | 65 | 11 Jul 2022 |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: MASSTAAPPAAVPAIETAAPPSPEPRDSVSVNEGGDASSAQAGAAVGSTIIVGAPELEKEYSDLN
deepconcnf: ----------------------------EE------HHHHHH------EEEE----HHHHH----
psipred: ----------------------------EEE-----HHHHH-------EEEE--HHHHHHH----
spider3: ------------------------------------------------EEE--------------
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington