2022-07-02_00000191_1_11 Domain 1 Parse 1 Confidence: 0.07

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
355920CompleteStructure predictioncameo2022-07-02_00000191_1_1111872 Jul 2022-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
362184110.07comparative modeling1-656512 Jul 2022
             1   .   10    .   20    .   30    .   40    .   50    .   60    .
   sequence: MASSTAAPPAAVPAIETAAPPSPEPRDSVSVNEGGDASSAQAGAAVGSTIIVGAPELEKEYSDLN
 deepconcnf: ----------------------------EE------HHHHHH------EEEE----HHHHH----
    psipred: ----------------------------EEE-----HHHHH-------EEEE--HHHHHHH----
    spider3: ------------------------------------------------EEE--------------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington