2022-07-16_00000237_1_19 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
370714 | Complete | Structure prediction | RoseTTAFold | 2022-07-16_00000237_1_19 | 73 | 16 Jul 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
367059 | 1 | 1 | 0.93 | RoseTTAFold | 1-73 | 73 | 16 Jul 2022 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: PLGSTHLEDSLRHDPRGHQRQRLIDCLNEAARRLALELRQPHSADEYARLERQRQSCLAAVRVIDTLWTLHQG
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington