2022-07-23_00000074_1_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 378984 | Complete | Structure prediction | RoseTTAFold | 2022-07-23_00000074_1_19 | 78 | 23 Jul 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 374421 | 1 | 1 | 0.85 | RoseTTAFold | 1-78 | 78 | 23 Jul 2022 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 .
sequence: GSMATACTIQLRGGQIMTLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHKCLAEGGKIMKIPGTCCDTCE
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington