T0964_dom1_custom Domain 1 Parse 1 Confidence: 0.93

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
247CompleteStructure predictioncaspT0964_dom1_custom9525 May 2018-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
380110.93comparative modeling1-959525 May 2018
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
   sequence: NVPVTGVTVNPTTAQVEVGQSVQLNASVAPSNATNKQVTWSVSGSSIASVSPNGLVTGLAQGTTTVTATTADGNKAASATITVAPGGGVTQGTPE
 deepconcnf: ------EEE-----EE----EEEEEEEE---------EEEEE----EEEE-----EEEEE--EEEEEEEE----EEEEEEEEEE-----------
    psipred: ---EEEEEE----EEEE---EEEEEEEEE-------EEEEEE----EEEEE---EEEEEEEEEEEEEEEE----EEEEEEEEEE-----------
    spider3: -----EEEE---EEEEE---EEEEEEEEE--------EEEEE-----EEE-----EEE---EEEEEEEEE----EEEEEEEEE------------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington