2022-07-30_00000029_1_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 385859 | Complete | Structure prediction | RoseTTAFold | 2022-07-30_00000029_1_19 | 44 | 30 Jul 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 381042 | 1 | 1 | 0.65 | RoseTTAFold | 1-44 | 44 | 30 Jul 2022 |
1 . 10 . 20 . 30 . 40
sequence: QPRSHVDCPALHGQCQSLPCTYPLVFVGPDPFHCGPYPQFGCCA
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington