| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 388803 | Complete | Structure prediction | RoseTTAFold | 2022-08-06_00000179_1_19 | 76 | 6 Aug 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 383919 | 1 | 1 | 0.86 | RoseTTAFold | 1-76 | 76 | 6 Aug 2022 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 .
sequence: GSAKDPKMPLHILTHRECEVLQLLTDGKSNRGIGETLFISEKTVKNHVSSILQKMKVNDRTQAVVTAIKHGWVYIR
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington