2022-08-20_00000174_1_11 Domain 3 Parse 1 Confidence: 0.38
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 398442 | Error | Structure prediction | cameo | 2022-08-20_00000174_1_11 | 1295 | 20 Aug 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 393719 | 3 | 1 | 0.38 | comparative modeling | 1196-1287 | 92 | 20 Aug 2022 |
1200 . 1210 . 1220 . 1230 . 1240 . 1250 . 1260 . 1270 . 1280 .
sequence: KLHNTTVELAILIDNINNTLVNLEWLNRIETYVKSGGYIPEAPRDGQAYVRKDGEWVLLSTFLVPRGSGGSGGSGLNDIFEAQKIEWHEGGS
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington