2022-08-20_00000176_1_19 Domain 3 Parse 1 Confidence: 0.38

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
398445CompleteStructure predictionRoseTTAFold2022-08-20_00000176_1_19146920 Aug 2022-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
393733310.38comparative modeling1339-146112321 Aug 2022
                   . 1350    . 1360    . 1370    . 1380    . 1390    . 1400    . 1410    . 1420    . 1430    . 1440    . 1450    . 1460 
   sequence: NWTVPELTLDIFNATYLNLTGEIDDLEFRSEKLHNTTVELAILIDNINNTLVNLEWLNRIETYVKSGGYIPEAPRDGQAYVRKDGEWVLLSTFLVPRGSGGSGGSGLNDIFEAQKIEWHEGGS
    spider3: --------HHEE--EE-------HHHEEE-------EEEEEEEE------EE-EEEEEEEEEEE----E---------EEEE----EEEEEEEEE-------------HHHHHHHHHHH----
 deepconcnf: -----HHHHHHHHHH-----------EE--------HHHHHHHHHHHHH----HHHHHHHHHHHHH-----------EEEEEE--EEEEEEEEEEE----------HHHHHH-----------
    psipred: -----EEEHHHHHHHH-----------HHHHHH---EEEEEEEEE-----EEEHHHHHHHHHHHH-------------EEEE----EEEEEEEEEE----------HHHHHHHHEEEE-----
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington