2022-08-20_00000174_1_19 Domain 3 Parse 1 Confidence: 0.38

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
398443CompleteStructure predictionRoseTTAFold2022-08-20_00000174_1_19129520 Aug 2022-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
394080310.38comparative modeling1196-12879222 Aug 2022
              1200    . 1210    . 1220    . 1230    . 1240    . 1250    . 1260    . 1270    . 1280    .  
   sequence: KLHNTTVELAILIDNINNTLVNLEWLNRIETYVKSGGYIPEAPRDGQAYVRKDGEWVLLSTFLVPRGSGGSGGSGLNDIFEAQKIEWHEGGS
 deepconcnf: -----HHHHHHHHHHHHHH---HHHHHHHHHHHHH-----------EEEEEE--EEEEEEEEEEE----------HHHHHH-----------
    psipred: -----EEEEEEEEE----EEEEHHHHHHHHHHHH-------------EEEEE---EEEEEEEEEE----------HHHHHHHHEEEE-----
    spider3: ------EEEEEEE------EE-EEEEEEEEEEE----E---------EEEE----EEEEEEEEE-------------HHHHHHHHHHH----
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Alignment cluster 5 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington