| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 406442 | Error | Structure prediction | cameo | 2022-09-03_00000043_1_11 | 31 | 3 Sep 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 401536 | 1 | 1 | n/a | TrRefineRosetta | 1-31 | 31 | 3 Sep 2022 |
1 . 10 . 20 . 30
sequence: GGLHVLLTATPVGLTLLIVLAALGFFYGKKR
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington