2022-09-03_00000043_1_19 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
406443 | Complete | Structure prediction | RoseTTAFold | 2022-09-03_00000043_1_19 | 31 | 3 Sep 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
401537 | 1 | 1 | 0.89 | RoseTTAFold | 1-31 | 31 | 3 Sep 2022 |
1 . 10 . 20 . 30
sequence: GGLHVLLTATPVGLTLLIVLAALGFFYGKKR
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington