2022-09-10_00000085_1_19 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
409049 | Complete | Structure prediction | RoseTTAFold | 2022-09-10_00000085_1_19 | 44 | 10 Sep 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
404130 | 1 | 1 | 0.87 | RoseTTAFold | 1-44 | 44 | 10 Sep 2022 |
1 . 10 . 20 . 30 . 40
sequence: SNADDLREPEERHLDDAFFRGYKNLEPEAKAQLRKILDTFKKDF
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington