2022-09-24_00000147_3_19 Domain 1 Parse 1 Confidence: 0.00

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
419455ErrorStructure predictionRoseTTAFold2022-09-24_00000147_3_1911924 Sep 2022-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
41501111n/aRoseTTAFold1-11911927 Sep 2022
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .    
   sequence: QVQLVQSGSALKRPGASVKLSCKASGYTFINYAIHWVRQAPGQGLQWMGWINPNTGIPTYAQGFTGRFVFSLDTSVSTAYLQLSSLKIEDTAVYYCARDQDLYERAFDIWGQGTMVTVS



Baker Lab | Rosetta@home | Contact | Terms of Service
©2023 University of Washington