2022-09-24_00000257_1_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 419474 | Error | Structure prediction | RoseTTAFold | 2022-09-24_00000257_1_19 | 70 | 24 Sep 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 415100 | 1 | 1 | n/a | RoseTTAFold | 1-70 | 70 | 27 Sep 2022 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: MSGMEKFKEQLLEEVKKIVLETMTKVMEHLEKWFVTLAEIIITKSEEKLEELKETMEKSIEELRKEAEGS
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington