2022-10-01_00000226_1_19 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
421222 | Complete | Structure prediction | RoseTTAFold | 2022-10-01_00000226_1_19 | 64 | 1 Oct 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
416261 | 1 | 1 | 0.75 | RoseTTAFold | 11-64 | 54 | 2 Oct 2022 |
. 20 . 30 . 40 . 50 . 60
sequence: SSGLVPRGSHMDIEEIEKKARKILEKGDSIEIAGFEVRDEEDLKKILEWLRRHG
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington