2022-10-15_00000149_1_19 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
428123 | Complete | Structure prediction | RoseTTAFold | 2022-10-15_00000149_1_19 | 85 | 15 Oct 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
423539 | 1 | 1 | 0.71 | RoseTTAFold | 1-85 | 85 | 15 Oct 2022 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 .
sequence: GSHMASSGKKFYAKFGQRSARCNYKIQLDSNKIVDTVDIEDIGEKKAFCRCWKSEKWPYCDGSHGKHNKETGDNVGPLIVKSEKK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington