LCB3_LCB1 Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
43649CompleteStructure prediction LJS5LCB3_LCB11306 Nov 2020-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
4265311n/acomparative modeling1-1301306 Nov 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
   sequence: NDDELHMQMTDLVYEALHFAKDEEIQKHVFQLFEKATKAYKNKDRQKLEKVVEELKELLERLLSGGSGGSGGSGDKENILQKIYEIMKTLDQLGHAEASMQVSDLIYEFMKQGDERLLEEAERLLEEVER
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington