2022-12-03_00000139_2_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 455332 | Complete | Structure prediction | RoseTTAFold | 2022-12-03_00000139_2_19 | 90 | 3 Dec 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 450668 | 1 | 1 | 0.86 | RoseTTAFold | 1-90 | 90 | 3 Dec 2022 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90
sequence: GAGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKA
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington