2022-12-17_00000223_2_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 465720 | Error | Structure prediction | cameo | 2022-12-17_00000223_2_11 | 136 | 17 Dec 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 460978 | 1 | 1 | n/a | TrRefineRosetta | 11-136 | 126 | 17 Dec 2022 |
. 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 .
sequence: SSGLVPRGSHMTAGADETPDTRTALARRLAGLSPAEQEQHLVDMVHRHTVAALQAVAPLTPDQVDVQRPFLELGFDSLAAVDLHKRLTGETGLELPVTVAFDFPTPVLVAEEIRRIAFGIRPAPLA
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington