2022-12-24_00000226_1_19 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
468897 | Complete | Structure prediction | RoseTTAFold | 2022-12-24_00000226_1_19 | 157 | 24 Dec 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
464116 | 1 | 1 | 0.78 | RoseTTAFold | 1-151 | 151 | 24 Dec 2022 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150
sequence: MSNETIVIDIKGAVQHPGVYEMRTGDRVSQAIEKAGGTSEQADEAQVNLAEILQDGTVVYIPKKGEETAVQQGGGGSVQSDGGKGALVNINTATLEELQGISGVGPSKAEAIIAYREENGRFQTIEDITKVSGIGEKSFEKIKSSITVKLE
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington