2023-02-18_00000127_1_19 Domain 6 Parse 1 Confidence: 0.17
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 488601 | Error | Structure prediction | RoseTTAFold | 2023-02-18_00000127_1_19 | 1007 | 18 Feb 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 483803 | 6 | 1 | 0.17 | comparative modeling | 840-899 | 60 | 19 Feb 2023 |
. 850 . 860 . 870 . 880 . 890 .
sequence: KNITKEAGNTEPKSPVIQLYEALNKEKDQKQQSKQSPKQLDTKTQLGYLLKLGDNWSKDD
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington