2023-03-11_00000047_2_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 496380 | Complete | Structure prediction | RoseTTAFold | 2023-03-11_00000047_2_19 | 91 | 11 Mar 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 491296 | 1 | 1 | 0.94 | RoseTTAFold | 8-91 | 84 | 11 Mar 2023 |
10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90
sequence: YEKQVEITAENGLHTRPAAQFVKEAKAFDADITVTSNGKSASAKSLFKLQTLGLVKGTVVTISAEGPQAKEAVEHLVALMDQLH
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington