2023-03-18_00000027_1_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 498694 | Error | Structure prediction | cameo | 2023-03-18_00000027_1_11 | 62 | 18 Mar 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 493393 | 1 | 1 | n/a | TrRefineRosetta | 1-56 | 56 | 18 Mar 2023 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: MDGFDRGADVTYTDSDGSKKTYKVLSYSGDKVTVQDSDGRTLTFDARLLRVKKWLE
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington