2023-03-18_00000027_1_19 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
498695 | Complete | Structure prediction | RoseTTAFold | 2023-03-18_00000027_1_19 | 62 | 18 Mar 2023 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
493394 | 1 | 1 | 0.76 | RoseTTAFold | 1-56 | 56 | 18 Mar 2023 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: MDGFDRGADVTYTDSDGSKKTYKVLSYSGDKVTVQDSDGRTLTFDARLLRVKKWLE
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington