2023-03-25_00000252_2_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 500232 | Error | Structure prediction | cameo | 2023-03-25_00000252_2_11 | 32 | 25 Mar 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 495073 | 1 | 1 | n/a | TrRefineRosetta | 1-32 | 32 | 25 Mar 2023 |
1 . 10 . 20 . 30
sequence: GCRGLKRLYEAFCKQDSDCLAGCVCPMFSECG
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington