2023-03-25_00000113_1_19 Domain 1 Parse 1 Confidence: 0.32
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 500206 | Error | Structure prediction | RoseTTAFold | 2023-03-25_00000113_1_19 | 1876 | 25 Mar 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 495198 | 1 | 1 | 0.32 | comparative modeling | 1-112 | 112 | 26 Mar 2023 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110
sequence: MNTDQQPYQGQTDYTQGPGNGQSQEQDYDQYGQPLYPSQADGYYDPNVAAGTEADMYGQQPPNESYDQDYTNGEYYGQPPNMAAQDGENFSDFSSYGPPGTPGYDSYGGQYT
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington