2023-03-25_00000113_1_19 Domain 7 Parse 2 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
500206 | Error | Structure prediction | RoseTTAFold | 2023-03-25_00000113_1_19 | 1876 | 25 Mar 2023 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
495213 | 7 | 2 | n/a | ab initio | 916-1146 | 231 | 26 Mar 2023 |
920 . 930 . 940 . 950 . 960 . 970 . 980 . 990 . 1000 . 1010 . 1020 . 1030 . 1040 . 1050 . 1060 . 1070 . 1080 . 1090 . 1100 . 1110 . 1120 . 1130 . 1140 .
sequence: SQIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTISGFMNYSRAIKLLYRVENPEIVQMFGGNAEGLERELEKMARRKFKFLVSMQRLAKFKPHELENAEFLLRAYPDLQIAYLDEEPPLTEGEEPRIYSALIDGHCEILDNGRRRPKFRVQLSGNPILGDGKSDNQNHALIFYRGEYIQLIDANQDNYLEECLKIRSVLAEFEELNVEQVNPYAPGLRYEEQTTNH
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington