2023-03-25_00000113_1_11 Domain 1 Parse 1 Confidence: 0.32

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
500205CompleteStructure predictioncameo2023-03-25_00000113_1_11187625 Mar 2023-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
495810110.32comparative modeling1-11211228 Mar 2023
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110  
   sequence: MNTDQQPYQGQTDYTQGPGNGQSQEQDYDQYGQPLYPSQADGYYDPNVAAGTEADMYGQQPPNESYDQDYTNGEYYGQPPNMAAQDGENFSDFSSYGPPGTPGYDSYGGQYT
 deepconcnf: ----------------------------------------------------------------------------------------------------------------
    psipred: ---------------------------HHH----------------------------------------------------------------------------------
    spider3: ----------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington