2023-04-22_00000060_1_11 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
509665 | Error | Structure prediction | cameo | 2023-04-22_00000060_1_11 | 89 | 22 Apr 2023 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
504558 | 1 | 1 | n/a | TrRefineRosetta | 1-89 | 89 | 22 Apr 2023 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 .
sequence: GPHMGKHGRDDYDCTVIFRNNHAPERQPIVVHTYYSRDLPIELDGVRHTIQLSGCTPEQSQIPQGYSVEHMTYKNYLRQEILNERPFWP
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington