2023-04-22_00000043_1_11 Domain 3 Parse 1 Confidence: 0.16

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
509661CompleteStructure predictioncameo2023-04-22_00000043_1_11150722 Apr 2023-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
504672310.16comparative modeling426-4815622 Apr 2023
               430    .  440    .  450    .  460    .  470    .  480 
   sequence: VVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQS
    psipred: -------------------EEE---------EEE-------------HHHH-----
    spider3: ---------------------E--------EEEE----------------------
 deepconcnf: -------------------EEE---------EE-------------HHHHH-----
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington