2021-01-16_00000014_1_11 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
52415 | Complete | Structure prediction | cameo | 2021-01-16_00000014_1_11 | 57 | 16 Jan 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
51167 | 1 | 1 | 0.67 | TrRefineRosetta | 1-57 | 57 | 16 Jan 2021 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: GSMTLPPELSIIEIPFDDVETRSYEFIEVEIKGRGKAKLGKREFAWIPESGKYWADE
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington