2021-01-16_00000090_1_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 52420 | Complete | Structure prediction | cameo | 2021-01-16_00000090_1_11 | 105 | 16 Jan 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 51178 | 1 | 1 | 0.75 | TrRefineRosetta | 25-105 | 81 | 16 Jan 2021 |
30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 .
sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEGPQVGALELAGGPGAGGLEGPPQKRGIVEQCCASVCSLYQLENYCN
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington