2023-05-13_00000202_2_19 Domain 3 Parse 1 Confidence: 0.70

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
517278CompleteStructure predictionRoseTTAFold2023-05-13_00000202_2_19190513 May 2023-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
512344310.70comparative modeling314-43512214 May 2023
              .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .
   sequence: LDQFLCWNGRCIGQRKLCNGVNDCGDNSDESPQQNCRPRTGEENCNVNNGGCAQKCQMVRGAVQCTCHTGYRLTEDGHTCQDVNECAEEGYCSQGCTNSEGAFQCWCETGYELRPDRRSCKA
 deepconcnf: ---EE-----EE--------------------------------------------EE-----EEE-----EE-----------------------E-----EEEE-----EE------E--
    psipred: ---EE--------HHH----------------------------------------EE-----EEE-----EE---------------------EEE-----EEEE-----EE-----EE--
    spider3: ---EE-----EEEHHH---------------------------H-----------EE------EEE----EEE-----EEEE------------EEEE----EEEEE----EE---------
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington