ZX_S3C12 Mutant M14N Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 52564 | Complete | Structure prediction | LJS5 | ZX_S3C12 Mutant M14N | 75 | 17 Jan 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 51312 | 1 | 1 | 0.78 | TrRefineRosetta | 1-75 | 75 | 17 Jan 2021 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 .
sequence: PESALRRYVALRMNLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington