ZX_S3C12 Mutant M14R Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
52565 | Complete | Structure prediction | LJS5 | ZX_S3C12 Mutant M14R | 75 | 17 Jan 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
51313 | 1 | 1 | 0.79 | TrRefineRosetta | 1-75 | 75 | 17 Jan 2021 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 .
sequence: PESALRRYVALRMRLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington