2023-05-13_00000202_1_11 Domain 11 Parse 1 Confidence: 0.62

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
517264CompleteStructure predictioncameo2023-05-13_00000202_1_11206813 May 2023-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
5143131110.62comparative modeling1329-13886019 May 2023
                   . 1340    . 1350    . 1360    . 1370    . 1380    .   
   sequence: PPKPCDSQPCFHGGTCQDWALGGGFTCSCPAGRGGAVCEKVLGAPVPAFEGRSFLAFPTL
 deepconcnf: --------------EEEE------EEEE-----------EE------------EEE----
    psipred: --------------EEE-------EEE-------------------------EEEE----
    spider3: --------------EEEE------EEEE----------EEE-----------EEEE----
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington