2023-05-13_00000202_1_19 Domain 5 Parse 1 Confidence: 0.69

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
517265CompleteStructure predictionRoseTTAFold2023-05-13_00000202_1_19206813 May 2023-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
514332510.69comparative modeling598-6687119 May 2023
             600    .  610    .  620    .  630    .  640    .  650    .  660    .   
   sequence: PCETCGDAVCAFGAVCSAGQCVCPRCEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAE
 deepconcnf: --------------------EE------------------EE----HHHHHHH-----EEE----------
    psipred: --------------EE---EEE-----------EE-----EE--HHHHHHHHH----EEEEEE--------
    spider3: --------E-----EEEE-EEE-----------E----------HHHHHHHHHH-----EEEE--------
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington