2023-05-13_00000202_1_19 Domain 15 Parse 1 Confidence: 0.99

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
517265CompleteStructure predictionRoseTTAFold2023-05-13_00000202_1_19206813 May 2023-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
5143421510.99comparative modeling1893-19526019 May 2023
               . 1900    . 1910    . 1920    . 1930    . 1940    . 1950  
   sequence: EIPVPETLDSGALHSEKALQSNHFELSLRTEATQGLVLWSGKATERADYVALAIVDGHLQ
    psipred: ---EEEEE-------------EEEEEEEEE----EEEEEE--------EEEEEEE--EE-
    spider3: ----EEEE-------------EEEEEEEE-----EEEEEE--------EEEEEEE--EEE
 deepconcnf: -----EEE------------EEEEEEEEEE----EEEEEE--------EEEEEEE--EE-
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington