2023-05-20_00000035_1_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 519571 | Error | Structure prediction | cameo | 2023-05-20_00000035_1_11 | 100 | 20 May 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 514537 | 1 | 1 | n/a | TrRefineRosetta | 1-100 | 100 | 20 May 2023 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100
sequence: GASPPSPPRGIKVSEVTTRTARLSWQSPYGNGDNTVVTYIVRYWRDEESRSQLHQLTFQVTSANLKDLHPGTSYAVQILAENDVGASIPSRLVQFRTIEE
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington