2023-05-20_00000101_2_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 519589 | Complete | Structure prediction | RoseTTAFold | 2023-05-20_00000101_2_19 | 32 | 20 May 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 514552 | 1 | 1 | 0.94 | RoseTTAFold | 1-32 | 32 | 20 May 2023 |
1 . 10 . 20 . 30
sequence: MSVLVYSFASFVLGWCLRSGITYFTRLMETSS
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington