SSGCID - MymyA.20341.a Uncharacterized protein Domain 1 Parse 1 Confidence: 0.80

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
4984CompleteStructure predictionssgcidSSGCID - MymyA.20341.a Un...507 Jun 2019-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
5178110.80comparative modeling1-505010 Jun 2019
             1   .   10    .   20    .   30    .   40    .   50
   sequence: MSDNIKDLPFDEIIKRIKFYADLKAKNLITEEQNQEYELLKSWYLEIVLK
 deepconcnf: ---------HHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHH-
    psipred: ---------HHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHH-
    spider3: ---------HHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHH---
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington