SSGCID - MymyA.20329.a Uncharacterized protein Domain 1 Parse 1 Confidence: 0.94

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
4970Domain completeStructure predictionssgcidSSGCID - MymyA.20329.a Un...667 Jun 2019-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
5181110.94comparative modeling1-666610 Jun 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    . 
   sequence: MNYEELEIGDIIELKKPHPSKTIRWELIRIGAKYKFRSCDQFDLFIELNRQTLKIQLKKIIKKTIK
 deepconcnf: ----------EEEEE---------EEEEEE--EEEEEE-----EEEEEEHHHHHHHHHHHHHH---
    psipred: ----------EEEE---------EEEEEEE--EEEEEE------EEEEEHHHHHHHHHHHHH----
    spider3: ----------EEEEE---------EEEEEEEEEEEEEE-----EEEEEEHHHHHHHHHHHH-----
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington