2023-05-27_00000312_1_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 522343 | Complete | Structure prediction | RoseTTAFold | 2023-05-27_00000312_1_19 | 195 | 27 May 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 518360 | 1 | 1 | 0.64 | RoseTTAFold | 8-195 | 188 | 29 May 2023 |
10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 .
sequence: SSGVDLWSHPQFEKGTENLYFQSNIMNLEDLAKKTISEVSSIMEEQRRQNEILKEQELNRKTEIKDELPPMEFVCEELDTPQDLEDKISMAKFEEEQKIQNNIEISTQENKEFKKEEPFLQNEILNPSVMTEVQTLNEDIFLKHLRERILVLFEGLNSIKKDDLENRLNLTINFLEFLLANIEDKLKK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington