2023-06-03_00000069_2_19 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
526157 | Complete | Structure prediction | RoseTTAFold | 2023-06-03_00000069_2_19 | 51 | 3 Jun 2023 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
521365 | 1 | 1 | 0.68 | RoseTTAFold | 1-51 | 51 | 4 Jun 2023 |
1 . 10 . 20 . 30 . 40 . 50
sequence: PYFVETPYGFQLDLDFVKYVDDIQKGNTIKKGGGGITTIKEMGRSIHEIPR
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington