| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 537359 | Error | Structure prediction | cameo | 2023-07-22_00000083_1_11 | 35 | 22 Jul 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 532224 | 1 | 1 | n/a | TrRefineRosetta | 1-35 | 35 | 22 Jul 2023 |
1 . 10 . 20 . 30 .
sequence: ACREWLGGCSKDADCCAALECRKKWPYHCVWDWTV
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington